PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.H00670.1.p
Common NameLOC105970948, MIMGU_mgv1a021306mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 538aa    MW: 58881.7 Da    PI: 7.313
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.H00670.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.53.7e-30246302259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +DgynWrKYGqK+vk se+prsYY+Ct+ +Cpvkkkvers  d++v eitY+g+H h+
  Migut.H00670.1.p 246 NDGYNWRKYGQKNVKASECPRSYYKCTYINCPVKKKVERSF-DGRVSEITYKGHHIHD 302
                       8****************************************.**************97 PP

2WRKY106.11.8e-33423481159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK+vkg+++prsYYrCt+agC+v+k+ver++ dpk+v++tYeg+H+he
  Migut.H00670.1.p 423 LDDGYKWRKYGQKVVKGNPHPRSYYRCTYAGCNVRKHVERASADPKAVITTYEGKHDHE 481
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.2E-27235304IPR003657WRKY domain
PROSITE profilePS5081122.423240304IPR003657WRKY domain
SuperFamilySSF1182903.14E-24242304IPR003657WRKY domain
SMARTSM007744.9E-33245303IPR003657WRKY domain
PfamPF031061.1E-22246301IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.5E-36409483IPR003657WRKY domain
SuperFamilySSF1182902.48E-29415483IPR003657WRKY domain
PROSITE profilePS5081137.034418483IPR003657WRKY domain
SMARTSM007741.5E-39423482IPR003657WRKY domain
PfamPF031065.8E-26424480IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MGETTVEDAS GNRKSKPTTI LVPPRGSMES LFSNGSIGGF GFSPGPMTLV SNYFAEQGPF  60
SFSQLLAGAM SSPTTGLLMT NYPPAAAAEQ EEEKEKEKES NSSDDGKNSE SGGGGGGYKR  120
NRPMDLVVAQ PQMPPESLSP MFMVPPGLSP SGFLNSPGFL SPLSSPFGMS HRQALAHVTA  180
QAAFSQTYMQ MQSQLQRSPS IESLAPHHQT SIIPVSTVPD ASKIDSFEVS QSDNKSSNIV  240
ADKPANDGYN WRKYGQKNVK ASECPRSYYK CTYINCPVKK KVERSFDGRV SEITYKGHHI  300
HDPPQSNKRG KDGCALDKTV KSQAKSDVMN RLNEAAYVKC EPVNFQATTQ RLFERNPMIC  360
YNGEVGDSVV VVDDCENNDD DNDCEPVSKR RSVDNGQSIA ASTHETITET KIVVQTRSEV  420
DLLDDGYKWR KYGQKVVKGN PHPRSYYRCT YAGCNVRKHV ERASADPKAV ITTYEGKHDH  480
ELPVGRYSSH GAVNCNSNQF KTQKTANKKP MPSIEMDFGN MDSTPMTLQL KEETIAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A9e-37246483877Probable WRKY transcription factor 4
1wj2_A9e-37246483877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012851239.10.0PREDICTED: probable WRKY transcription factor 4
TrEMBLA0A022RVZ90.0A0A022RVZ9_ERYGU; Uncharacterized protein
STRINGVIT_14s0108g01280.t011e-159(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43142344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-102WRKY DNA-binding protein 4